Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320108.1	5prime_partial	127	452-69(-)
Amino Acid sequence :
SFRQRLYNQSGNSQPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKNLLSSKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKN CRKISSS*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,144.692
Theoretical pI:		9.652
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		47.878
aromaticity		0.102
GRAVY		-0.587
Secondary Structure Fraction
Helix		0.268
turn		0.331
sheet		0.197