Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320115.1 | 3prime_partial | 153 | 460-2(-) |
Amino Acid sequence : | |||
MLSRRSPYSIFFAILFATINFTPLVSGIDTQTPGGSILELYMHDILGGNNPTARPITGLLGNIYSGQVPFARPLGFQPPKDGVAIPNANGAMPTFNINGVPLGTGLAGTTFAGGNNNNNN GQTLNTQLGPDGLGLGFGTITVIDDYLTSSPEL | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,881.748 | ||
Theoretical pI: | 4.651 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 44.437 | ||
aromaticity | 0.085 | ||
GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.392 | ||
sheet | 0.203 |