Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320121.1 | internal | 152 | 456-1(-) |
Amino Acid sequence : | |||
KDGHVERMFGSPIVPPSLEDPTTGVASKDIDISPDIRARVYLPKLTNTTNEKLPILVYYHGGGFCLESAFSFLDHRYLNLIVSEAKVIAISVEYRLAPEHPLPIAYEDSWTALQWVASHV LENPGFEKEPWLVNHGNFEKVLIGGDSAGGNI | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,827.871 | ||
Theoretical pI: | 5.125 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 31.730 | ||
aromaticity | 0.099 | ||
GRAVY | -0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.276 | ||
sheet | 0.250 |