Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320122.1 | 5prime_partial | 144 | 520-86(-) |
Amino Acid sequence : | |||
IIAQLLGSTAACGLLEFATGMSTGSFALGADVSVWSALVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMNPAVSFGPSLVSWTWTHQWVYWAGPLIGG GLAGFIYEFIFTSHTHEQIPSGDF* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 14,953.028 | ||
Theoretical pI: | 4.486 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 15.585 | ||
aromaticity | 0.139 | ||
GRAVY | 0.797 | ||
Secondary Structure Fraction | |||
Helix | 0.389 | ||
turn | 0.271 | ||
sheet | 0.257 |