Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320138.1 | internal | 196 | 588-1(-) |
Amino Acid sequence : | |||
LFSAYMDEVAAFAQEPFKQVDIAIPEVFVGGLLGSMLIFLFSAWACAAVGRTAQEVVNEVRRQFIERPGIMEYKEKPDYGRCVSIVASASLREMIKPGALAIISPTAVGFLFRILGYYTG HPLLGAKVVASMLMFATVSGILMALFLNTAGGAWDNAKKYIETGALGGKGSDTHKAAITGDTVGDPFKDTAGPSLH | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 20,884.044 | ||
Theoretical pI: | 6.344 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 23.839 | ||
aromaticity | 0.102 | ||
GRAVY | 0.352 | ||
Secondary Structure Fraction | |||
Helix | 0.332 | ||
turn | 0.224 | ||
sheet | 0.306 |