Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320143.1 | internal | 178 | 534-1(-) |
Amino Acid sequence : | |||
NKRSAMGDIAPTSRHNRSISMDSFMGKLNFVDDSLKLPPSPGPRPGQLSPTNSLDGNSNSFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYITELE HKVQTLQTEATTLSAQLTLLQRDSAGITSQNSELKFRLQAMEQQAQLRDALNEALTAE | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,660.971 | ||
Theoretical pI: | 9.472 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 52.204 | ||
aromaticity | 0.039 | ||
GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.264 | ||
sheet | 0.326 |