Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320145.1 | 5prime_partial | 134 | 609-205(-) |
Amino Acid sequence : | |||
VNRPTSSRNFMPEPGSPEYEELKTNPDKVFLRTIVSQWQTLLEISVLEVLSRHASDEVYLGQRDSPEWTKDQEPLSAFERFGKKLSDIEDQIMQMNADEKWKNRTGPVKVPYTLLFPTSD EGLTGKGIPNSISI* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,298.026 | ||
Theoretical pI: | 4.946 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 37.031 | ||
aromaticity | 0.082 | ||
GRAVY | -0.696 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.276 | ||
sheet | 0.231 |