Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320148.1 | internal | 164 | 492-1(-) |
Amino Acid sequence : | |||
AVVLKPSDLAPKCSSFLANTIPLYLDREAIKVVEGGKDVAEELLQLKWDKIFFTGSPKVARIIMSAAAKHLTPVTLELGGKCPAIFDNLSNSSDLQVAVKRIVGAKWGSCNGQACIAIDY VLVGTQFASVLIEQLKKFIKRFYGESVKTLENLARSVNKHHFDR | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 17,989.811 | ||
Theoretical pI: | 9.195 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 35.993 | ||
aromaticity | 0.079 | ||
GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.207 | ||
sheet | 0.262 |