Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320149.1 | 3prime_partial | 196 | 66-653(+) |
Amino Acid sequence : | |||
MEVISNHNNGSTTKIILKNGSICNGNSHSHENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPK KVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAI | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,469.206 | ||
Theoretical pI: | 5.175 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 26.499 | ||
aromaticity | 0.107 | ||
GRAVY | 0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.270 | ||
sheet | 0.209 |