Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320150.1	internal	132	396-1(-)
Amino Acid sequence :
LINNLDEPIQVQPLEEVNGNEQLCTLCEEYTAKAVNYMANNKTETEIIDLLHKSCLKVPFYKKECAILVDYYAPLFFLEINRIRPEDFCQTFGLCERVVTISQVFSGKNCDLCHQVVTEV KKKLKDPDTQLE
Physicochemical properties
Number of amino acids:		132
Molecular weight:		15,235.393
Theoretical pI:		4.877
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7950
Instability index:		52.068
aromaticity		0.083
GRAVY		-0.233
Secondary Structure Fraction
Helix		0.341
turn		0.159
sheet		0.265