Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320150.1 | internal | 132 | 396-1(-) |
Amino Acid sequence : | |||
LINNLDEPIQVQPLEEVNGNEQLCTLCEEYTAKAVNYMANNKTETEIIDLLHKSCLKVPFYKKECAILVDYYAPLFFLEINRIRPEDFCQTFGLCERVVTISQVFSGKNCDLCHQVVTEV KKKLKDPDTQLE | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 15,235.393 | ||
Theoretical pI: | 4.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7950 | ||
Instability index: | 52.068 | ||
aromaticity | 0.083 | ||
GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.159 | ||
sheet | 0.265 |