Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320160.1 | 5prime_partial | 107 | 355-32(-) |
Amino Acid sequence : | |||
FVLVYVVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILRAGAIKALGSFRSNA* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,617.358 | ||
Theoretical pI: | 9.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 28.867 | ||
aromaticity | 0.150 | ||
GRAVY | 0.571 | ||
Secondary Structure Fraction | |||
Helix | 0.402 | ||
turn | 0.234 | ||
sheet | 0.224 |