Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320160.1	5prime_partial	107	355-32(-)
Amino Acid sequence :
FVLVYVVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILRAGAIKALGSFRSNA*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		11,617.358
Theoretical pI:		9.599
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22460
Instability index:		28.867
aromaticity		0.150
GRAVY		0.571
Secondary Structure Fraction
Helix		0.402
turn		0.234
sheet		0.224