Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320162.1 | internal | 169 | 508-2(-) |
Amino Acid sequence : | |||
VGQYPQVPLYESMGIDDANIPHKAEKFTQILWPQGNPTFCETIQSYSEQLSELDKTVRRMIIESLGVENYMDEHMSSTNYLLRVMKYKGPQSSETKIGLNAHTDKNIVTILYQNQVNGLE VLTKDGQWFNVNPTPDSFTVMIGDSLYAWANGRVHSPYHRVMMTGNEAR | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 19,291.558 | ||
Theoretical pI: | 5.485 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 29910 | ||
Instability index: | 45.445 | ||
aromaticity | 0.095 | ||
GRAVY | -0.522 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.260 | ||
sheet | 0.219 |