Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320164.1 | internal | 155 | 3-467(+) |
Amino Acid sequence : | |||
RVLTGSGTPLKPDEPLNVYLFALFNENQKPGPTSERNYGLFYPNEQKVYDIPLTREGLETGPTVNNGSKSVVVMAPTSSPLPAPVNGGGNVEANKVVNTWCVANEKAPREKLQAALDYAC GQGRADCRPIQPGATCYDPDTLEAHASYAFNSYYQ | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,782.516 | ||
Theoretical pI: | 5.149 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 31.575 | ||
aromaticity | 0.090 | ||
GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.323 | ||
sheet | 0.239 |