Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320174.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
DVIDSCTIIIWVASALHAAVNFGQYPYGGYLVNRPTLSRNFMPEPGNPEYEELKTNPDKVFLKTIVSQWQTLLEISVLEVLSRHASDEVYLGQRDSPEWTRDQEPLSAFERFGKKLSDIE HQIM* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,226.887 | ||
Theoretical pI: | 4.841 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 35.616 | ||
aromaticity | 0.105 | ||
GRAVY | -0.352 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.234 | ||
sheet | 0.250 |