Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320175.1 | 3prime_partial | 139 | 417-1(-) |
Amino Acid sequence : | |||
MASLISSWAAQVNSVPERYVVPSEKRFNINVPIGKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEKE YKPKKNDKEVFSGKIHLPI | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,829.034 | ||
Theoretical pI: | 5.035 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 47.955 | ||
aromaticity | 0.086 | ||
GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.237 | ||
sheet | 0.259 |