Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320177.1 | internal | 111 | 334-2(-) |
Amino Acid sequence : | |||
IGKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTDEEEELSEFEPNLDQKPKLSIEKEYKPKKNGKSDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,471.619 | ||
Theoretical pI: | 10.123 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 42.282 | ||
aromaticity | 0.230 | ||
GRAVY | 0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.510 | ||
turn | 0.170 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320177.1 | complete | 100 | 2-304(+) |
Amino Acid sequence : | |||
MRKCIFPENYFFITLAILLRFIFFFNGKFWFLVQIWLKFTQLFFFISILLQFLNWQLEKLPTNFQNISNQLFRHSMVNHLKDSILLRSFDDFSNYILRRQ* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 12,471.619 | ||
Theoretical pI: | 10.123 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 42.282 | ||
aromaticity | 0.230 | ||
GRAVY | 0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.510 | ||
turn | 0.170 | ||
sheet | 0.210 |