Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320178.1	complete	165	130-627(+)
Amino Acid sequence :
MENLLGLLRIRILRGINLAIRDVTTSDPYVVVKMAKQKLKTRVVKKNVNPEWNEDLTLSVTEPILPIKLQVYDKDIFSLDDKMGDAEIDILPFIDAVRKRFKNIPSGTIIRKIKPSRQNC LSEESSIVWENDQVVQNVFIRLRNVERGEIELQLQWIDIPHSKGL*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		19,101.087
Theoretical pI:		9.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19480
Instability index:		47.554
aromaticity		0.055
GRAVY		-0.244
Secondary Structure Fraction
Helix		0.370
turn		0.200
sheet		0.218