Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320183.1	internal	102	306-1(-)
Amino Acid sequence :
PVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVPKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEKEYKPKKNDKEVFSGKIHLPI
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,740.391
Theoretical pI:		4.851
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4470
Instability index:		45.931
aromaticity		0.088
GRAVY		-0.361
Secondary Structure Fraction
Helix		0.363
turn		0.206
sheet		0.284