Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320194.1 | internal | 106 | 320-3(-) |
Amino Acid sequence : | |||
VNTGHLTTRSDIYSFGVVLLELLTGRRAMDKTRPKNEQNLVDWTRPYLSSSRRLRCIMDPRLGGQYSVKGAKEMAHLASVCTSLNPKDRPKMPAIIETLEALVPAR | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,909.725 | ||
Theoretical pI: | 9.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 50.495 | ||
aromaticity | 0.047 | ||
GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.236 | ||
sheet | 0.274 |