Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320201.1 | internal | 203 | 610-2(-) |
Amino Acid sequence : | |||
NEKTENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKID IVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,263.190 | ||
Theoretical pI: | 4.746 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 34.331 | ||
aromaticity | 0.118 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.241 | ||
sheet | 0.227 |