Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320209.1 | internal | 165 | 495-1(-) |
Amino Acid sequence : | |||
GQVPRKERYCGCLRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSESSRSKFNQTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINK TSEGKEFPVSAFVFASPKVGDLNFQKAFSKLKHLHILRIHNLLDI | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,400.815 | ||
Theoretical pI: | 7.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 35.093 | ||
aromaticity | 0.097 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.242 | ||
sheet | 0.242 |