Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320215.1	internal	134	3-404(+)
Amino Acid sequence :
IDQLSISSPKLSPNTDGIHIENTKFVGIYNSIIANGDDCISIGPGSSNVEIEAVTCGPSHGISIGSLGVYHSQACVSNITVRNAIIRNSDNGVRIKTWQGGSGSVTGLSFDTIQMENVRN CIIIDQYYCMTKGC
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,224.856
Theoretical pI:		5.431
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11835
Instability index:		34.884
aromaticity		0.052
GRAVY		-0.006
Secondary Structure Fraction
Helix		0.299
turn		0.351
sheet		0.104