Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320217.1 | 3prime_partial | 127 | 382-2(-) |
Amino Acid sequence : | |||
MRMLDYICEGLGPKLGYFDNELSQIQMMLTNDYPPCPDPSSTLGSGGHYDGNLITLLQQDLPGLQQLIVKDATWIAVQPIPTAFVVNLGLTLKVITNEKFEGSIHRVVTDPTRDRVSIAT LIGPDYS | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,977.894 | ||
Theoretical pI: | 4.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 27.553 | ||
aromaticity | 0.071 | ||
GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.260 | ||
sheet | 0.220 |