Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320231.1 | 3prime_partial | 163 | 489-1(-) |
Amino Acid sequence : | |||
MTLKVYEWKSRGWKEVDDLLTGFHGECNYPTVCGRYGIYTMGQCSCPESSTNSTVYFRPINDRRPDLGCSEVTRLTCNSKKHRLLEVEDVDYFAFNADISNTDVKTCKEACLKKCSCKAA FFRSGLNSSRATTRGECYLPTNIFSLLNNEKDKTRYESVAFIK | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,600.910 | ||
Theoretical pI: | 8.458 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23545 | ||
Instability index: | 30.892 | ||
aromaticity | 0.110 | ||
GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.233 | ||
sheet | 0.196 |