Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320237.1 | internal | 136 | 409-2(-) |
Amino Acid sequence : | |||
NFGLFRPDFTPVYNIGVLKGEQAHPTPSSPAPKAGGSTKDQPKSKSPVVGPPAQKKQFCMPKAEATDAQLQSNINYVCSQGVDCTPVQVGGSCFTPNTIRSHAAFVMNSYYQKMGRNNFN CDFAGTGVVASADPSY | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,466.108 | ||
Theoretical pI: | 8.859 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 57.900 | ||
aromaticity | 0.096 | ||
GRAVY | -0.453 | ||
Secondary Structure Fraction | |||
Helix | 0.221 | ||
turn | 0.346 | ||
sheet | 0.147 |