Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320238.1 | 5prime_partial | 178 | 601-65(-) |
Amino Acid sequence : | |||
APITTNSGSAATPYDIGSGEASPSLALNPGLVYETTAADYLQFLCAIGYDKSKIKLISNTVPNDFSCPTSSSSESVSQMNYPSIGVSNIKENETKKVIRTLTNVAEDEATYTASIKAPAG LEVQVTPNKLAFTINSKKLSYEVSFKVSSKPKEDLFGSITWTNSKYNVRSPYVVTTGL* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,053.152 | ||
Theoretical pI: | 6.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 28.752 | ||
aromaticity | 0.084 | ||
GRAVY | -0.240 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.320 | ||
sheet | 0.208 |