Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320248.1	internal	135	406-2(-)
Amino Acid sequence :
SFILNENEAPFLPRKYAASIPFSMEKLPEILNLFSIDSKSKDAAEIEKTIKLCEEPEVKHKEKRTCVASLESMVDFGLSVLGTNDILVVTSEVKGETQDSQLYIIEQVEQIADGNNMVCH KLNYPYALHYCHVGG
Physicochemical properties
Number of amino acids:		135
Molecular weight:		15,136.130
Theoretical pI:		4.945
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7700
Instability index:		55.369
aromaticity		0.074
GRAVY		-0.200
Secondary Structure Fraction
Helix		0.319
turn		0.222
sheet		0.289