Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320255.1	5prime_partial	104	383-69(-)
Amino Acid sequence :
AAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKNLLSSKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKNCRKISSS*
Physicochemical properties
Number of amino acids:		104
Molecular weight:		11,470.931
Theoretical pI:		9.745
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3105
Instability index:		40.387
aromaticity		0.096
GRAVY		-0.371
Secondary Structure Fraction
Helix		0.279
turn		0.317
sheet		0.221