Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320255.1 | 5prime_partial | 104 | 383-69(-) |
Amino Acid sequence : | |||
AAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKNLLSSKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKNCRKISSS* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,470.931 | ||
Theoretical pI: | 9.745 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 40.387 | ||
aromaticity | 0.096 | ||
GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.317 | ||
sheet | 0.221 |