Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320279.1 | complete | 146 | 3-443(+) |
Amino Acid sequence : | |||
MQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHILPQVLDMTTSPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVITATKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVEL AEDPDVDVRFYANQALQSIDNVMMSG* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,439.029 | ||
Theoretical pI: | 5.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 58.419 | ||
aromaticity | 0.062 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.192 | ||
sheet | 0.288 |