Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320289.1 | internal | 193 | 579-1(-) |
Amino Acid sequence : | |||
GAVGSVVAEAIRKERRMGASLIRLFFHDCFVDGCDAGILLNDIPGRFQGEKSSPPNDNSVRGYEVIDEAKQRIKTMCPAASVSCADILALAARDSVAMLGGIPYPVRLGRRDARTANFTG ALTQLPAPFDDLNVQLTKFRAKGMSAREMVALAGAHTVGFARCVTMCDDRNINPARKSTLNCGCPVNNNNTNL | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 13,716.704 | ||
Theoretical pI: | 9.832 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 41.576 | ||
aromaticity | 0.069 | ||
GRAVY | 0.434 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.277 | ||
sheet | 0.292 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320289.1 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
KFVLLLLTGQPQFNVDFLAGLMFLSSHIVTQRANPTVWAPANATISRADIPFALNFVNWTLRSSNGAGSCVNAPVKLAVLASLRPSLTGYGIPPNIATESRAARARISAQETDAAGHIVL ILCLASSITS* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,716.704 | ||
Theoretical pI: | 9.832 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 41.576 | ||
aromaticity | 0.069 | ||
GRAVY | 0.434 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.277 | ||
sheet | 0.292 |