Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320296.1 | internal | 149 | 448-2(-) |
Amino Acid sequence : | |||
TSSLQGDVKFAEVLEMMGAEVTWTENSVTVKGPLRNSAGMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLNVTE IDTYDDHRMAMAFSLAACADVPVTIKDPS | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,248.614 | ||
Theoretical pI: | 4.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 34.692 | ||
aromaticity | 0.047 | ||
GRAVY | 0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.181 | ||
sheet | 0.302 |