Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320298.1	internal	99	298-2(-)
Amino Acid sequence :
GRAPAIPSILGVYKTVLFLGIKPVFITGTAEKFRNVRIANLKKVGYGNWAKLVLKGENDAASAVGFKSSKRTELVKAGYRIVGNIGDQWTDLIGENVGA
Physicochemical properties
Number of amino acids:		99
Molecular weight:		10,605.216
Theoretical pI:		10.060
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15470
Instability index:		4.405
aromaticity		0.091
GRAVY		0.047
Secondary Structure Fraction
Helix		0.354
turn		0.263
sheet		0.222