Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320303.1 | internal | 155 | 465-1(-) |
Amino Acid sequence : | |||
YLTSASLRKTMASLVSSWAAQVNSVPERYVVPSQKRLNINVPIGKDIPVIDLSLPSQNIVDQIIKASQEYRLFQVINHGVSKELIGDVLKVCGEFFKLPIEELEKYTDEEEELSEFEPNL DQKPKLFIEKEYKPKKNGKSDKEVIFWKDTFAHCT | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 12,571.773 | ||
Theoretical pI: | 9.651 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 40.802 | ||
aromaticity | 0.218 | ||
GRAVY | 0.390 | ||
Secondary Structure Fraction | |||
Helix | 0.515 | ||
turn | 0.149 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320303.1 | 5prime_partial | 101 | 1-306(+) |
Amino Acid sequence : | |||
GTMRKCIFPENYFFITLAILLRFIFFFNEKFWFLVQIWLKFTQLFFFISILLQFLNWQLEKLPTNFQNITNQLFRDSMVNHLKESILLRSFDDLINYILRR* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 12,571.773 | ||
Theoretical pI: | 9.651 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 40.802 | ||
aromaticity | 0.218 | ||
GRAVY | 0.390 | ||
Secondary Structure Fraction | |||
Helix | 0.515 | ||
turn | 0.149 | ||
sheet | 0.238 |