Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320304.1 | internal | 169 | 509-3(-) |
Amino Acid sequence : | |||
HKHGNTAVSWIRNLFHDCMVKSCDASVYLDTANGQESEKTSPRNFGMRNFKYIETIKQALENECPNTVSCADIVALSARDGLLWLGGPRVEMRTGRKDSKESYLAEVENYLPSHNDSMSS VLSRFQSIGVDTEGTVALLGAHSVGRVHCVNLVHRLYPTVDPTIDPDYA | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,743.842 | ||
Theoretical pI: | 5.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 38.380 | ||
aromaticity | 0.071 | ||
GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.260 | ||
sheet | 0.231 |