Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320307.1 | internal | 132 | 398-3(-) |
Amino Acid sequence : | |||
FPKNISVIAVCPKGMGPSVRRLYVQGKEVNGAGINASFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFGERGILLGAVHGVVESLFRRYTENGMNDELAYKNTVECITGV ISKTISTKGVLA | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,124.952 | ||
Theoretical pI: | 6.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 32.631 | ||
aromaticity | 0.083 | ||
GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.258 | ||
sheet | 0.227 |