Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320309.1 | internal | 148 | 445-2(-) |
Amino Acid sequence : | |||
LTSASLRKTMASLVSSWAAQVNSVPERYVVPSQKRLNINVPIGKDIPVIDLSLPSQNIVDQIIKASQEYGLFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQ KPKLFIEKEYKPKKNDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,948.265 | ||
Theoretical pI: | 5.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 42.889 | ||
aromaticity | 0.088 | ||
GRAVY | -0.330 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.216 | ||
sheet | 0.257 |