Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320320.1 | internal | 201 | 604-2(-) |
Amino Acid sequence : | |||
IKITGVSNNASSQHLATLSGHTAPVWQATWAHPKFGSLLASCSYDGKVIIWKEGNQNEWAQAHVFSDHKSSVNSISWAPHELGLCLACGSSDGNISVHTARSDGGWDTTRIDQAHPVGVT SVSWAPSMAPGALVGSGVLEPVQKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEN | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 21,442.848 | ||
Theoretical pI: | 6.806 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 63480 63730 | ||
Instability index: | 29.828 | ||
aromaticity | 0.080 | ||
GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.313 | ||
sheet | 0.214 |