Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320335.1	internal	143	3-431(+)
Amino Acid sequence :
KPDSPKLCPPYHTFPNGTRVHRNETSLFPYEAYHLYCAPGNGEHVEKPSISCDPYSNPHPQEIMQILPHPAWGEYGYPTTKGQGWIGDPRTWELDVGRLSHPLYFYQDPGTAPAKRKWSS IDLGTEIFKDPNQVAEWTVSDFD
Physicochemical properties
Number of amino acids:		143
Molecular weight:		14,226.847
Theoretical pI:		9.635
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1740
Instability index:		55.664
aromaticity		0.057
GRAVY		0.283
Secondary Structure Fraction
Helix		0.366
turn		0.146
sheet		0.276

Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320335.1	5prime_partial	123	1-372(+)
Amino Acid sequence :
ANQIAQNCVLHTTHSRMEQEFIETRHLYFPMRLTICIVHQGMGSMLRSLVFHVTLTAIHILRRLCRFCHIRLGVNMVILLRKDKVGLEIQELGNLMLEGCHILFIFTRILAPHQQRGSGV QLT*
Physicochemical properties
Number of amino acids:		123
Molecular weight:		14,226.847
Theoretical pI:		9.635
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1740
Instability index:		55.664
aromaticity		0.057
GRAVY		0.283
Secondary Structure Fraction
Helix		0.366
turn		0.146
sheet		0.276