Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320336.1	internal	144	434-3(-)
Amino Acid sequence :
PNMQTMRLISRAAFEVDDYWRIVDILHKRLSRFDTRNWRPSYKALMLLEYLLTHGPESMAEEFQSDEDVITQMGSFQYVDEKGFNWGLSVRKMSERVIKLLEDRSHLKEERERARKVTVG IKGFGSFCERPISGQETMKEAISE
Physicochemical properties
Number of amino acids:		144
Molecular weight:		16,981.204
Theoretical pI:		6.423
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22460
Instability index:		32.733
aromaticity		0.097
GRAVY		-0.622
Secondary Structure Fraction
Helix		0.292
turn		0.188
sheet		0.285