Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320339.1	internal	156	469-2(-)
Amino Acid sequence :
KMFIKLAILFVFLSIKFAPFIGAVDHVTPQESILELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFQPPKDGVAIPNANGAMPTFNINGVPLGTGLAGTTFAGVNNNNNNNGQT VNTQLGPDGLGLGFGTITVIDDFLTSSPELGTCPGG
Physicochemical properties
Number of amino acids:		156
Molecular weight:		16,155.270
Theoretical pI:		5.037
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		41.272
aromaticity		0.083
GRAVY		0.208
Secondary Structure Fraction
Helix		0.321
turn		0.365
sheet		0.205