Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320341.1	3prime_partial	202	63-668(+)
Amino Acid sequence :
MEVISNHNNGSTTKIILKNGSICNGNVNGNSHSNEKTENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPHTEMIVHLPL GSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDA
Physicochemical properties
Number of amino acids:		202
Molecular weight:		22,049.756
Theoretical pI:		5.198
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21555
Instability index:		25.846
aromaticity		0.099
GRAVY		-0.077
Secondary Structure Fraction
Helix		0.337
turn		0.282
sheet		0.208