Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320346.1 | internal | 102 | 308-3(-) |
Amino Acid sequence : | |||
VAVEGFYEWKKDGSKKQSYYIHFKDARPLVLAALFDSWKNSEGEVLYTFSILTTSVSSSLEWLHDRMPVILGKKDAVDMWLRGSPSSNIDTLLKPYEESDLA | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,648.070 | ||
Theoretical pI: | 5.287 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 50.351 | ||
aromaticity | 0.127 | ||
GRAVY | -0.303 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.235 | ||
sheet | 0.265 |