Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320347.1	internal	164	494-3(-)
Amino Acid sequence :
NVETGRKDGSVSLASNVNLPAPSISVSDSIKAFAAKNLTPTDMVYLIGGHTVGIAHCSLIQDRLYNFNKTGGPDPTMSKWLLLGLRMRCPKGSTFDNTVPLDVRTPSLVDNSFFQQIRRG NGVLQIDQQIALDELTKDIVDGIVKRPDFYTKFGEAMVKLGKVE
Physicochemical properties
Number of amino acids:		164
Molecular weight:		17,925.362
Theoretical pI:		8.587
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10095
Instability index:		26.052
aromaticity		0.067
GRAVY		-0.172
Secondary Structure Fraction
Helix		0.311
turn		0.268
sheet		0.195