| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >HB454878.1 | complete | 151 | 125-580(+) |
Amino Acid sequence : | |||
| MATVRLPTAYTFGFAPPSRTTSAFVKAPSSFGSVKSLSNTLGMKAKPDSRIIPLATYKVKLIGPDGECCEFDAPEDCYILDSAENAGIELPYSCRAGACSTCAGKMASGTVDQSDGSFLD DNQMKEGYLLTCVSYPTSDCVIHTHKECDLY* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,135.125 | ||
| Theoretical pI: | 4.912 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10930 | ||
| Instability index: | 46.019 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.265 | ||
| sheet | 0.238 | ||