Acc_NO	ORF type	length	start-end position (strand +/-)
>HB856514.1	internal	179	539-3(-)
Amino Acid sequence :
AMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAP GAVANRVAVEACVKARNEGRDLAAEGNAIIREACKWSPELAAACEVWKEIKFEFKAVDT
Physicochemical properties
Number of amino acids:		179
Molecular weight:		19,509.988
Theoretical pI:		6.061
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28990 29115
Instability index:		44.056
aromaticity		0.078
GRAVY		-0.099
Secondary Structure Fraction
Helix		0.302
turn		0.212
sheet		0.268