Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HE574621.1 | internal | 185 | 1-555(+) |
Amino Acid sequence : | |||
AGVKDYRLTYYTPQYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEETQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALR LEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDF | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,466.971 | ||
Theoretical pI: | 6.834 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 30.371 | ||
aromaticity | 0.119 | ||
GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.232 | ||
sheet | 0.238 |