Acc_NO	ORF type	length	start-end position (strand +/-)
>HE963682.1	internal	193	3-581(+)
Amino Acid sequence :
YTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAY VKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDR
Physicochemical properties
Number of amino acids:		193
Molecular weight:		21,742.396
Theoretical pI:		8.389
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32890 33015
Instability index:		26.406
aromaticity		0.114
GRAVY		-0.463
Secondary Structure Fraction
Helix		0.306
turn		0.218
sheet		0.228