Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HE963703.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
YTPQYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEETQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAY SKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDR | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,576.105 | ||
Theoretical pI: | 5.954 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 35.093 | ||
aromaticity | 0.114 | ||
GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.238 | ||
sheet | 0.228 |