Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HE967493.1 | internal | 237 | 3-713(+) |
Amino Acid sequence : | |||
LRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKHFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWKF YLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNLFHYY | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 28,297.544 | ||
Theoretical pI: | 9.644 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43110 | ||
Instability index: | 35.849 | ||
aromaticity | 0.186 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.224 | ||
sheet | 0.186 |