Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>HE967498.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
FSAENLQKALVPPRENRRFSLFLWNSYVYECESFLVSLLKQFYHSRSLLYGSFPDRTHFDKKIKHIIIFPVKISTKRIWLLKYPFIYYVRYGERSLIALKGTHLQVKRCRYHLFNFWQYY FHLWSQPYRVCILELSKIYFYFLGHFLSFKMKTLVVRTKMLDDLLISDIIAKEFNPIAPIRSILLYLTKERFCDISGQPISRLSWTNLSDDDILDRFDRMCRNIFHYY | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 27,828.306 | ||
Theoretical pI: | 9.631 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52830 53080 | ||
Instability index: | 47.391 | ||
aromaticity | 0.184 | ||
GRAVY | -0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.175 | ||
sheet | 0.202 |